PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G20560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 114aa    MW: 12143.1 Da    PI: 8.3555
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G20560.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP66.31.1e-2063114253
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53 
                      a++k +++++h+kv+ R R +R+++ c ar+F+L+ eL +++d +tieWLl+
  OPUNC03G20560.1  63 AVRKPPSKDRHSKVDCRSRCIRMPIICVARVFQLTCELSHKSDAQTIEWLLR 114
                      789***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.59469114IPR017887Transcription factor TCP subgroup
PfamPF036348.1E-1769113IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MRVEEGVGEV LVLVVGVSGD GVIVEGEASV VPFHVHSGGG ATAAALDKQL VPAVSKANGT  60
TLAVRKPPSK DRHSKVDCRS RCIRMPIICV ARVFQLTCEL SHKSDAQTIE WLLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407989e-75AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047769e-75AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149589e-75AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126109e-75CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629543.17e-37PREDICTED: transcription factor TCP21-like
TrEMBLA0A0E0KF634e-78A0A0E0KF63_ORYPU; Uncharacterized protein
STRINGBGIOSGA005319-PA3e-32(Oryza sativa Indica Group)
STRINGORGLA02G0333700.16e-32(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2383522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.13e-27TCP family protein